PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_05386A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 200aa    MW: 21184.2 Da    PI: 6.9454
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_05386AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.62.4e-4461051100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +Ca+Ck+lrr+C+kdC++ap fpa++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq
  Oropetium_20150105_05386A   6 PCASCKLLRRRCTKDCIFAPFFPADDPHKFAIVHKVFGASNVSKMLQELPVQQRGDAVSSLVYEANARMRDPVYGCVGAISFLQ 89 
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                +q++ql+ +la++++e
  Oropetium_20150105_05386A  90 NQVSQLQMQLAVAQAE 105
                                ***********99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4265106IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-436103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MGGGSPCASC KLLRRRCTKD CIFAPFFPAD DPHKFAIVHK VFGASNVSKM LQELPVQQRG  60
DAVSSLVYEA NARMRDPVYG CVGAISFLQN QVSQLQMQLA VAQAEILCIQ MQRRDVEDDH  120
QGVPAVAAAA LVAAGGDHHH HHVMAAHHNH QATAAAAMMA PEDVDAFLMH SGGGQQLMAG  180
GYGSAAAAGE ALKRESLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963862.11e-102PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW36e-72LBD12_ARATH; LOB domain-containing protein 12
TrEMBLK3ZCF41e-102K3ZCF4_SETIT; Uncharacterized protein
STRINGSi024229m1e-101(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-71LBD family protein